streamwriter write to file but put spaces very 10th character

Question

1.00/5 (1 vote)

See more:

Hi all,
I would like to write the sequence below but put in a space every 10th character. I would also like to only go until 100 characters and start a new line. The example is below
Any suggestions?
Thanks in advance

VB

MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVAD
ESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGK

MKWVTFISL LLLFSSAYSR GVFRRDTHKS return at 100 characters to the next line

Posted 5-Jun-11 6:53am

shekarchee

Add a Solution

Comments

Sergey Alexandrovich Kryukov 5-Jun-11 13:37pm

School assignment. Who will be interested to solve this boring problem for you? It's trivial: try to do it by yourself and ask a question if you face any problem. This is the way CodeProject really helps, not the other way around.
--SA

1 solution

Add a Solution

Add your solution here

Treat my content as plain text, not as HTML

Preview 0

…

Existing Members

Sign in to your account

...or Join us

Download, Vote, Comment, Publish.

Your Email
Password
Forgot your password?

Your Email
This email is in use. Do you need your password?
Optional Password

I have read and agree to the Terms of Service and Privacy Policy
Please subscribe me to the CodeProject newsletters

When answering a question please:

Read the question carefully.
Understand that English isn't everyone's first language so be lenient of bad spelling and grammar.
If a question is poorly phrased then either ask for clarification, ignore it, or edit the question and fix the problem. Insults are not welcome.
Don't tell someone to read the manual. Chances are they have and don't get it. Provide an answer or move on to the next question.

Let's work to help developers, not make them feel stupid.

This content, along with any associated source code and files, is licensed under The Code Project Open License (CPOL)

OriginalGriff · Accepted Answer · 2011-06-05T07:49:00

Since this is homework, I am not going to give you code.
However, what you need to do is:
1) Set up a counter to find your 100th character break, start with 0
2) Set up a loop to process the string.
3) Use SubString twice to remove the first ten characters into the stream.
4) If you have reached the 100th character, output a new line and reset your counter
Otherwise, output a space.
5) Continue the loop until you run out of characters.